PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR06G13540.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 140aa    MW: 15262.7 Da    PI: 12.2008
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR06G13540.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.43.2e-171158249
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     rie k  rq+tfskR   +lK A+ELSv ++a vav++fs+tg++y +
  LPERR06G13540.1 11 RIEKKESRQTTFSKRGPVVLKMASELSVRTGASVAVVVFSETGRVYAF 58
                     8*********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.259262IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-14261IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-11424IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.93E-17663IPR002100Transcription factor, MADS-box
PfamPF003192.8E-181158IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-112439IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-113960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MVAGRTILMR RIEKKESRQT TFSKRGPVVL KMASELSVRT GASVAVVVFS ETGRVYAFGT  60
PSSAATSSPQ LAGRIKGAIR AGRVHWWDAD AEALGLTELV RALERVRDSV RRPSAADVLL  120
SAGGQPKQKP RRRRAQAKHK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D9WQN62e-95A0A0D9WQN6_9ORYZ; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11880.15e-14AGAMOUS-like 14